PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000249947
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family NAC
Protein Properties Length: 542aa    MW: 60142.8 Da    PI: 5.6041
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000249947genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM128.93.9e-40281553128
            NAM   3 pGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.k 96 
                    pGfrF Pt+e lv++yL+kk+eg++ ++ ++i+e+d+ k+eP dLp    + +ekew+fFs+ d ky +++r nrat++g+ k tgk++e++++ +
  MDP0000249947  28 PGFRFYPTEELLVSHYLRKKIEGTDSHFRHFIPEIDVSKHEPCDLPaFYPDVHEKEWFFFSRPDYKYVNSTRCNRATEQGFYKITGKEREIKAEqS 123
                    9***************************999***************556666999*************************************9856 PP

            NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                    ++++g k+tL+fy+gr p+++ktdW++hey l
  MDP0000249947 124 KAVIGKKRTLTFYEGRVPNATKTDWIVHEYYL 155
                    6679**************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.57E-4426176IPR003441NAC domain
PROSITE profilePS5100545.95526178IPR003441NAC domain
PfamPF023657.0E-2028154IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MSSSSSSNRS GMTAEEGDAV SVNVIPLPGF RFYPTEELLV SHYLRKKIEG TDSHFRHFIP  60
EIDVSKHEPC DLPAFYPDVH EKEWFFFSRP DYKYVNSTRC NRATEQGFYK ITGKEREIKA  120
EQSKAVIGKK RTLTFYEGRV PNATKTDWIV HEYYLTETEV GSKPTKRMDF VICRLKNNSA  180
SYKKPKIDSI CGELADSGVT SEEDRDAVSD VIAXPVEHLG SKEPGDVNRS ESPDGSCPMD  240
CNGILTIDDG DDGDDGTGGW KFNFDDPVAS DMVRELCAEG EIPNSPSEPL QPPQTPQPHQ  300
PQDYYPRTLQ PLQSPQPHQP QDYCPSTLQQ PLHTRHGIDP YXYGDCTKRQ SLSPDDISSP  360
EYKNSISTND PNEQVSKLAN GVQDRATDSE VREAAEYCIA LHLPWKKTKT ESWKHTVLKQ  420
ATIGFFHRSI SSKPSIKSPM GNGDRAITVS NKEENKDIQL QLAILRVVIA VAGWGRSRDR  480
GGGDDGGRDG NHGDDRVGRD HSRGGKYAHE DGNGWGDSDS GGGGGGGDGH GKKVVVATRW  540
WE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B2e-32101842171NAC domain-containing protein 19
4dul_A2e-32101842171NAC domain-containing protein 19
1ut7_B2e-32101842171NO APICAL MERISTEM PROTEIN
1ut7_A2e-32101842171NO APICAL MERISTEM PROTEIN
1ut4_B2e-32101842171NO APICAL MERISTEM PROTEIN
1ut4_A2e-32101842171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008376240.10.0PREDICTED: NAC domain-containing protein 68-like
TrEMBLM5X4Q71e-109M5X4Q7_PRUPE; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13710524
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35580.11e-39NAC transcription factor-like 9